|
HS Code |
292028 |
| Product Name | GLP-1 Raw Material |
| Chemical Formula | C181H282N52O45 |
| Molecular Weight | 3751.2 g/mol |
| Appearance | White or off-white powder |
| Purity | ≥98% |
| Solubility | Soluble in water |
| Cas Number | 106612-94-6 |
| Storage Temperature | -20°C |
| Peptide Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Source | Synthetic |
| Pharmacopoeia Grade | Research |
| Stability | Stable for 1 year at -20°C |
| Usage | Pharmaceutical intermediate |
| Expiration Period | 12 months |
| Packing | Sealed vial |
As an accredited GLP-1 Raw Material factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | GLP-1 Raw Material is packaged in a sealed, sterile 10g vial, labeled with product name, batch number, and storage guidelines. |
| Shipping | GLP-1 Raw Material is shipped in temperature-controlled, sealed containers to maintain stability and prevent contamination. Packaging complies with international chemical transport regulations. Shipments include proper labeling, documentation, and safety data sheets, ensuring secure and traceable delivery for research or manufacturing purposes. Handle with care to avoid exposure or degradation. |
| Storage | GLP-1 Raw Material should be stored in a tightly sealed container, protected from light and moisture. The storage area must be cool and dry, ideally at 2–8°C (refrigerated conditions). Ensure the material is kept away from incompatible substances and maintained under controlled conditions to preserve its stability, potency, and to prevent degradation or contamination. |
Competitive GLP-1 Raw Material prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please call us at +8615651039172 or mail to sales9@foods-additive.com.
We will respond to you as soon as possible.
Tel: +8615651039172
Email: sales9@foods-additive.com
Flexible payment, competitive price, premium service - Inquire now!