West Ujimqin Banner, Xilingol League, Inner Mongolia, China sales9@foods-additive.com 1531585804@qq.com
Follow us:

GLP-1 Raw Material

    • Product Name GLP-1 Raw Material
    • Alias Semaglutide
    • Einecs NA
    • Mininmum Order 1 g
    • Factory Site West Ujimqin Banner, Xilingol League, Inner Mongolia, China
    • Price Inquiry sales9@foods-additive.com
    • Manufacturer Alchemist Worldwide Ltd
    • CONTACT NOW
    Specifications

    HS Code

    292028

    Product Name GLP-1 Raw Material
    Chemical Formula C181H282N52O45
    Molecular Weight 3751.2 g/mol
    Appearance White or off-white powder
    Purity ≥98%
    Solubility Soluble in water
    Cas Number 106612-94-6
    Storage Temperature -20°C
    Peptide Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
    Source Synthetic
    Pharmacopoeia Grade Research
    Stability Stable for 1 year at -20°C
    Usage Pharmaceutical intermediate
    Expiration Period 12 months
    Packing Sealed vial

    As an accredited GLP-1 Raw Material factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing GLP-1 Raw Material is packaged in a sealed, sterile 10g vial, labeled with product name, batch number, and storage guidelines.
    Shipping GLP-1 Raw Material is shipped in temperature-controlled, sealed containers to maintain stability and prevent contamination. Packaging complies with international chemical transport regulations. Shipments include proper labeling, documentation, and safety data sheets, ensuring secure and traceable delivery for research or manufacturing purposes. Handle with care to avoid exposure or degradation.
    Storage GLP-1 Raw Material should be stored in a tightly sealed container, protected from light and moisture. The storage area must be cool and dry, ideally at 2–8°C (refrigerated conditions). Ensure the material is kept away from incompatible substances and maintained under controlled conditions to preserve its stability, potency, and to prevent degradation or contamination.
    Free Quote

    Competitive GLP-1 Raw Material prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please call us at +8615651039172 or mail to sales9@foods-additive.com.

    We will respond to you as soon as possible.

    Tel: +8615651039172

    Email: sales9@foods-additive.com

    Get Free Quote of Alchemist Worldwide Ltd

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance